Hirundo rustica (Barn swallow): 120754549 Help Entry 120754549         CDS       T09369                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism hrt  Hirundo rustica (Barn swallow) Pathway hrt04010   MAPK signaling pathway hrt04068   FoxO signaling pathway hrt04081   Hormone signaling hrt04114   Oocyte meiosis hrt04140   Autophagy - animal hrt04150   mTOR signaling pathway hrt04810   Regulation of actin cytoskeleton hrt04910   Insulin signaling pathway hrt04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:hrt00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120754549 (INS)    04068 FoxO signaling pathway     120754549 (INS)    04150 mTOR signaling pathway     120754549 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     120754549 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120754549 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     120754549 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120754549 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     120754549 (INS)    04914 Progesterone-mediated oocyte maturation     120754549 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hrt04052]     120754549 (INS) Cytokines and neuropeptides [BR:hrt04052]  Neuropeptides   Unclassified    120754549 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  120754549 NCBI-ProteinID:  XP_039924220 LinkDB All DBs Position 6:complement(47968703..47971930) Genome browser AA seq 137 aa AA seqDB search MGTLLPTVFIPQSELLSTSCCQLLGLSLPTMALWIRSLPLLALLALSGPGSSHAAVNQHL CGSHLVEALYLVCGERGFFYQPKARRDVEQPLVSGPLHGELGELPFQQEEFEKVKRGIVE QCCHNTCSLYQLENYCN NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atggggacattgctaccaaccgtcttcatccctcagagcgaacttctctccacctcttgc tgccagctcttgggcctcagcctgcccaccatggctctctggatccgatcgctgcccctc ctggccctcctggctctttctggccccgggagcagccacgcggctgtcaaccagcacctc tgcggctcccacttggtggaagctctgtacctggtgtgtggggagcggggcttcttctac caacccaaagcccggcgggacgttgagcagcctctggtgagcggtcccttgcatggtgag ttgggagagctgcccttccagcaggaggagtttgagaaagtgaagcgagggattgttgag caatgctgccacaacacctgctccctctaccagctggaaaactactgtaactag

DBGET integrated database retrieval system