Hirundo rustica (Barn swallow): 120755715 Help Entry 120755715         CDS       T09369                                  Symbol BBIP1 Name (RefSeq) BBSome-interacting protein 1   KO K19399   BBSome-interacting protein 1 Organism hrt  Hirundo rustica (Barn swallow) Brite KEGG Orthology (KO) [BR:hrt00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hrt03037]     120755715 (BBIP1) Cilium and associated proteins [BR:hrt03037]  Primary cilia and associated proteins   BBSome    120755715 (BBIP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BBIP10 Motif Other DBs NCBI-GeneID:  120755715 NCBI-ProteinID:  XP_039927042 LinkDB All DBs Position 8:complement(26425448..26428388) Genome browser AA seq 73 aa AA seqDB search MPEGTGALREVLPKQGQLAMEDTAAMVLCKPKILPLKSVSLEKLEKLQRAALEAAQAPEA APPPSAGAAPPRQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgccggaggggacgggagcgctccgggaggtgctgcccaagcaagggcagctggcgatg gaggacacggccgccatggtgctgtgcaagcccaagatcctgcccctcaagtcggtgtcg ctggagaagctggagaagctgcagagggcggcgctggaggcggcccaggcgcccgaggcg gccccgccgccatccgcgggggccgcgccgccgcggcagtag

DBGET integrated database retrieval system