Hirundo rustica (Barn swallow): 120756996 Help Entry 120756996         CDS       T09369                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism hrt  Hirundo rustica (Barn swallow) Pathway hrt04810   Regulation of actin cytoskeleton hrt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hrt00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     120756996 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120756996 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hrt04131]     120756996 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:hrt04812]     120756996 (PFN2)    04147 Exosome [BR:hrt04147]     120756996 (PFN2) Membrane trafficking [BR:hrt04131]  Others   Actin-binding proteins    Others     120756996 (PFN2) Cytoskeleton proteins [BR:hrt04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      120756996 (PFN2) Exosome [BR:hrt04147]  Exosomal proteins   Proteins found in most exosomes    120756996 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  120756996 NCBI-ProteinID:  XP_039929874 LinkDB All DBs Position 10:25652147..25657481 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQSITPGEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccattgtgggctactgcgacgccaagtacgtctgggcagccacggccggcggcatcttc cagagcatcacgccaggagaaatagatatgattgtaggaaaagaccgagagggtttcttc accaatggtctgacccttggtgcaaagaagtgctctgtgatcagagatagcctgtatgtc gatggcgactgcacaatggacatcaggacaaagagtcaaggtggtgagccgacatataat gttgctgtaggcagagctggacgagtcttggtctttgtaatgggcaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system