Hirundo rustica (Barn swallow): 120758077 Help Entry 120758077         CDS       T09369                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism hrt  Hirundo rustica (Barn swallow) Pathway hrt04081   Hormone signaling hrt04144   Endocytosis hrt04150   mTOR signaling pathway hrt04270   Vascular smooth muscle contraction hrt04310   Wnt signaling pathway hrt04350   TGF-beta signaling pathway hrt04510   Focal adhesion hrt04520   Adherens junction hrt04530   Tight junction hrt04621   NOD-like receptor signaling pathway hrt04625   C-type lectin receptor signaling pathway hrt04810   Regulation of actin cytoskeleton hrt05100   Bacterial invasion of epithelial cells hrt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hrt00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     120758077 (RHOA)    04350 TGF-beta signaling pathway     120758077 (RHOA)    04150 mTOR signaling pathway     120758077 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     120758077 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120758077 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     120758077 (RHOA)    04520 Adherens junction     120758077 (RHOA)    04530 Tight junction     120758077 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120758077 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120758077 (RHOA)    04625 C-type lectin receptor signaling pathway     120758077 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     120758077 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120758077 (RHOA)    05100 Bacterial invasion of epithelial cells     120758077 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hrt04131]     120758077 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hrt04147]     120758077 (RHOA)    04031 GTP-binding proteins [BR:hrt04031]     120758077 (RHOA) Membrane trafficking [BR:hrt04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     120758077 (RHOA) Exosome [BR:hrt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120758077 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    120758077 (RHOA)   Exosomal proteins of colorectal cancer cells    120758077 (RHOA)   Exosomal proteins of bladder cancer cells    120758077 (RHOA) GTP-binding proteins [BR:hrt04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     120758077 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  120758077 NCBI-ProteinID:  XP_039931817 LinkDB All DBs Position 12:complement(3617184..3640673) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggagatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccaccgtctttgaa aattacgtagcagatattgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaggaagactacgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttagaaaacatccctgagaagtggacc ccggaggtgaagcatttctgccccaacgtgcctatcatcctggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgttaaa cccgaggaaggccgggatatggcaaaccgcattggtgcattcgggtacatggagtgttcg gcaaagaccaaagacggtgtgagggaggtgtttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system