Hirundo rustica (Barn swallow): 120762833 Help Entry 120762833         CDS       T09369                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism hrt  Hirundo rustica (Barn swallow) Pathway hrt04010   MAPK signaling pathway hrt04012   ErbB signaling pathway hrt04068   FoxO signaling pathway hrt04137   Mitophagy - animal hrt04140   Autophagy - animal hrt04150   mTOR signaling pathway hrt04210   Apoptosis hrt04218   Cellular senescence hrt04370   VEGF signaling pathway hrt04371   Apelin signaling pathway hrt04540   Gap junction hrt04625   C-type lectin receptor signaling pathway hrt04810   Regulation of actin cytoskeleton hrt04910   Insulin signaling pathway hrt04912   GnRH signaling pathway hrt04916   Melanogenesis Brite KEGG Orthology (KO) [BR:hrt00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120762833 (NRAS)    04012 ErbB signaling pathway     120762833 (NRAS)    04370 VEGF signaling pathway     120762833 (NRAS)    04371 Apelin signaling pathway     120762833 (NRAS)    04068 FoxO signaling pathway     120762833 (NRAS)    04150 mTOR signaling pathway     120762833 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120762833 (NRAS)    04137 Mitophagy - animal     120762833 (NRAS)   09143 Cell growth and death    04210 Apoptosis     120762833 (NRAS)    04218 Cellular senescence     120762833 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     120762833 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120762833 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120762833 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     120762833 (NRAS)    04912 GnRH signaling pathway     120762833 (NRAS)    04916 Melanogenesis     120762833 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hrt04131]     120762833 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hrt04147]     120762833 (NRAS)    04031 GTP-binding proteins [BR:hrt04031]     120762833 (NRAS) Membrane trafficking [BR:hrt04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     120762833 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     120762833 (NRAS) Exosome [BR:hrt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120762833 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    120762833 (NRAS)   Exosomal proteins of breast cancer cells    120762833 (NRAS)   Exosomal proteins of colorectal cancer cells    120762833 (NRAS) GTP-binding proteins [BR:hrt04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120762833 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  120762833 NCBI-ProteinID:  XP_039941577 LinkDB All DBs Position 24:2786013..2794772 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQG CMGLSCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtcgtggtgggcgccggcggcgtgggcaagagcgcgctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggactcgtac cgcaagcaggtggtgatcgatggcgagacgtgtctgctggacatcctggacacggcgggg caggaggagtacagcgccatgagggaccagtacatgaggacgggcgagggattcctctgc gtgttcgccatcaacaacagcaaatccttcgccgacatcaacctctacagagaacagatc aagagagtgaaggactcggatgacgtgcccatggtgctggtggggaacaagtgtgatctg cccacgagaacagtggacacaaaacaggcccaagaattggcaaaaagctacggaatcccc ttcatagagacctctgcaaaaacgagacagggtgtggaagatgctttttacaccctggtg agagagatccggcagtaccggatgaagaagctgaacagcagcgaggatgggaaccagggc tgcatgggattgtcctgccttgtcatgtga

DBGET integrated database retrieval system