Hirundo rustica (Barn swallow): 120763547 Help Entry 120763547         CDS       T09369                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism hrt  Hirundo rustica (Barn swallow) Pathway hrt04140   Autophagy - animal hrt04144   Endocytosis hrt04530   Tight junction Brite KEGG Orthology (KO) [BR:hrt00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120763547 (RAB8A)    04140 Autophagy - animal     120763547 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     120763547 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hrt04131]     120763547 (RAB8A)    03036 Chromosome and associated proteins [BR:hrt03036]     120763547 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hrt04147]     120763547 (RAB8A)    04031 GTP-binding proteins [BR:hrt04031]     120763547 (RAB8A) Membrane trafficking [BR:hrt04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     120763547 (RAB8A)  Autophagy   Other autophagy associated proteins     120763547 (RAB8A) Chromosome and associated proteins [BR:hrt03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     120763547 (RAB8A) Exosome [BR:hrt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120763547 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    120763547 (RAB8A)   Exosomal proteins of colorectal cancer cells    120763547 (RAB8A) GTP-binding proteins [BR:hrt04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     120763547 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU MMR_HSR1 SRPRB DUF3963 Motif Other DBs NCBI-GeneID:  120763547 NCBI-ProteinID:  XP_039942916 LinkDB All DBs Position 26:1532307..1539982 Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCALFRFSEDAFNATFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIRNWVRNIEEHASPDVEKMILG NKCDANDKRQVSREQGEKLAASFGIKFMETSAKANINIENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITQDQQKKSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgactatctgttcaagctgctgctgatcggcgactcgggcgtgggc aagacctgtgccctgttccgcttctccgaggacgccttcaacgccaccttcatctccacc atcggtatcgactttaaaattagaacgatagagctcgatggcaagagaatcaagctgcag atctgggacacggccgggcaggagcgattccggaccatcacaaccgcctactacagggga gccatgggcattatgttggtgtatgacatcaccaatgaaaagtcttttgaaaatattcgg aactgggtgaggaatattgaagagcacgcctctccagatgttgaaaaaatgatcctgggg aacaaatgtgatgcaaatgacaaaagacaagtctctagagagcaaggggagaagcttgcc gcaagttttgggattaaattcatggagaccagtgcaaaagcaaatataaacatagagaat gcatttttcactcttgcaagagatatcaaagcgaaaatggacaagaagttggaaggcaat agccctcaaggcagcaaccagggagtcaaaatcacacaagaccagcaaaagaaaagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system