Hirundo rustica (Barn swallow): 120765293 Help Entry 120765293         CDS       T09369                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism hrt  Hirundo rustica (Barn swallow) Pathway hrt04621   NOD-like receptor signaling pathway hrt05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hrt00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120765293  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120765293  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hrt03110]     120765293 Chaperones and folding catalysts [BR:hrt03110]  Protein folding catalysts   Protein disulfide isomerase    120765293 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 AhpC-TSA DIM1 OST3_OST6 Glutaredoxin Thioredoxin_7 Thioredoxin_9 Redoxin Motif Other DBs NCBI-GeneID:  120765293 NCBI-ProteinID:  XP_039945919 LinkDB All DBs Position Z:complement(65509561..65519304) Genome browser AA seq 105 aa AA seqDB search MVKIVGSLVEFEEELKSAGEKLIVVDFSATWCGPCKMIKPFFHSLCEKYGDVVFIEIDVD DAQDVASHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETIKSLV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagatcgtgggtagcctggttgaatttgaggaagagctgaaatctgctggtgag aagcttatagtagttgacttctctgccacatggtgtggaccatgcaaaatgatcaagccc tttttccacagtttgtgtgagaagtatggggatgtggtattcatagaaatcgatgtggat gatgcccaggatgttgcttcacactgtgatgtgaagtgtatgccaacgttccagttttat aagaatggaaagaaggtgcaggagttctctggggccaataaagagaagctggaagagacc attaaaagtctagtctaa

DBGET integrated database retrieval system