Hirundo rustica (Barn swallow): 131378585 Help Entry 131378585         CDS       T09369                                  Symbol PRLH Name (RefSeq) prolactin-releasing peptide   KO K05269   prolactin-releasing peptide Organism hrt  Hirundo rustica (Barn swallow) Pathway hrt04080   Neuroactive ligand-receptor interaction hrt04081   Hormone signaling Brite KEGG Orthology (KO) [BR:hrt00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     131378585 (PRLH)    04081 Hormone signaling     131378585 (PRLH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hrt04052]     131378585 (PRLH) Cytokines and neuropeptides [BR:hrt04052]  Neuropeptides   GPCR binding    131378585 (PRLH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Prolactin_RP Motif Other DBs NCBI-GeneID:  131378585 NCBI-ProteinID:  XP_058277391 LinkDB All DBs Position 7:complement(38235057..38237241) Genome browser AA seq 85 aa AA seqDB search MKLGLTCLLWLLLVCLTLPAARGRVLERSMEIRNPDIDPSWYTGRGIRPVGRFGRRQALG GGGRGGGRGQPAHPHPHPPRRELNP NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaagctggggctcacctgcctcctgtggctgctgctcgtctgcctgaccctgcccgcc gcccgcggccgcgttctcgagcgctccatggagatcaggaacccggacatcgacccctcg tggtacacgggccgcgggatccggccggtggggcgctttgggaggcgacaagccctgggc gggggcggccgcggcggcgggcgcgggcagccagcccacccgcacccccaccctccccgg cgggagctgaacccctga

DBGET integrated database retrieval system