Haloterrigena salifodinae: JMJ58_13135 Help Entry JMJ58_13135       CDS       T07070                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hsal  Haloterrigena salifodinae Pathway hsal03010   Ribosome Brite KEGG Orthology (KO) [BR:hsal00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     JMJ58_13135   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     JMJ58_13135  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hsal03011]     JMJ58_13135    04121 Ubiquitin system [BR:hsal04121]     JMJ58_13135   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsal04147]     JMJ58_13135 Ribosome [BR:hsal03011]  Ribosomal proteins   Eukaryotes    Small subunit     JMJ58_13135   Archaea     JMJ58_13135 Ubiquitin system [BR:hsal04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    JMJ58_13135 Exosome [BR:hsal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    JMJ58_13135   Exosomal proteins of colorectal cancer cells    JMJ58_13135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Zn_ribbon_RPB9 Zn_Ribbon_TF Rcat_RNF216 Ribosomal_L37e Zn_ribbon_3 Cas12f1-like_TNB DUF7575 zf-C2H2_FBX41 HypA DUF5817 Motif Other DBs NCBI-ProteinID:  QRV13893 UniProt:  A0A8T8DXE2 LinkDB All DBs Position 2691734..2691868 Genome browser AA seq 44 aa AA seqDB search MPRHELYDDDGSTEREQCPRCGDAFLADHGDRQHCGKCGYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgccacgacacgaactctacgatgacgacggcagcaccgagcgcgaacagtgcccccgc tgcggggacgccttcctcgccgaccacggcgaccgccagcactgcggcaagtgcggctac accgagtgggagtaa

DBGET integrated database retrieval system