Halobacillus salinarum: MUN89_05200 Help Entry MUN89_05200       CDS       T09487                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism hsan  Halobacillus salinarum Pathway hsan00030   Pentose phosphate pathway hsan00051   Fructose and mannose metabolism hsan00710   Carbon fixation by Calvin cycle hsan01100   Metabolic pathways hsan01110   Biosynthesis of secondary metabolites hsan01120   Microbial metabolism in diverse environments hsan01200   Carbon metabolism hsan01230   Biosynthesis of amino acids Module hsan_M00004   Pentose phosphate pathway (Pentose phosphate cycle) hsan_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:hsan00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     MUN89_05200 (rpiB)    00051 Fructose and mannose metabolism     MUN89_05200 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     MUN89_05200 (rpiB) Enzymes [BR:hsan01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      MUN89_05200 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  UOQ46390 LinkDB All DBs Position 997647..998087 Genome browser AA seq 146 aa AA seqDB search MKVILASDHGGVNLRKEVMEVLTELNVEFEDTGCDCEGSVDYSDYAIPAAERVASGEFDK GIFICGTGIGMSISANKVKGIRAALVHDLFTAKVTREHNDSNVLCMGERVIGPGLAREIA KTWVQTEFEGGRHARRVNKVTEYEQQ NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgaaagtaatactggcttcagatcacggcggtgtgaaccttcgtaaggaagtaatggaa gttttgacggaattaaatgtggaatttgaagataccggctgtgattgtgaaggatctgtg gattattccgattacgctatcccggctgctgagcgcgtggccagcggcgaatttgataaa ggcattttcatttgcggcacaggcatcggcatgtcgatttcagccaacaaggttaaagga atccgtgctgcgcttgtgcatgatctttttacggccaaagtaacccgtgaacacaatgat tccaatgtgttatgcatgggcgaacgggtcatcggccctgggcttgcccgcgaaatcgca aaaacatgggttcagactgaatttgagggcggccgtcacgcgcgccgggttaataaagtt accgaatatgaacaacaataa

DBGET integrated database retrieval system