KEGG   Hymenobacter sublimis: MWH26_11615
Entry
MWH26_11615       CDS       T09379                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
hsb  Hymenobacter sublimis
Pathway
hsb00770  Pantothenate and CoA biosynthesis
hsb01100  Metabolic pathways
hsb01240  Biosynthesis of cofactors
Module
hsb_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:hsb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    MWH26_11615 (coaD)
Enzymes [BR:hsb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     MWH26_11615 (coaD)
SSDB
Motif
Pfam: CTP_transf_like
Other DBs
NCBI-ProteinID: UPL47842
UniProt: A0ABY4J4S6
LinkDB
Position
2796019..2796483
AA seq 154 aa
MRIALFPGSFDPFTNGHLDVVRRGTALFDEVIIAIGNNSSKQRYLPVEQMISLIEEIFRD
EPRVSVQAYKGLTADFAREVGARFLLRGLRNTTDFEYENTIAQANRHVNPALETVFLITS
PPLAAISSTIIREIHRFGGNVDDFVPFPLPPAAG
NT seq 465 nt   +upstreamnt  +downstreamnt
atgcgaattgccttgtttcctggctcctttgatcctttcaccaacggtcatttggatgta
gtacggcgcggtacggctttgtttgatgaggtgattattgccatcggcaacaacagtagc
aagcagcgctacttgcccgtagagcagatgattagcctaattgaggagatttttcgggac
gagccgcgggtgtcagtgcaagcctacaaggggctaacggccgattttgcccgcgaggta
ggtgcccggttcctgctccggggcctgcgcaacaccactgacttcgagtacgaaaacacc
attgcccaggccaaccgccacgttaacccagccctggaaaccgtattcctgattacctct
ccccccttggcggccattagcagtaccatcatccgcgaaattcaccgcttcggcggtaac
gtcgatgatttcgtacccttcccgctaccgccagcggccggctaa

DBGET integrated database retrieval system