Herbinix luporum: SD1D_0838 Help Entry SD1D_0838         CDS       T04072                                  Name (GenBank) hypothetical protein   KO K02408   flagellar hook-basal body complex protein FliE Organism hsd  Herbinix luporum Pathway hsd02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:hsd00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     SD1D_0838  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:hsd02035]     SD1D_0838 Bacterial motility proteins [BR:hsd02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     SD1D_0838 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FliE Motif Other DBs NCBI-ProteinID:  CUH92386 UniProt:  A0A0K8J405 LinkDB All DBs Position I:909166..909477 Genome browser AA seq 103 aa AA seqDB search MDITSIGSLNELSKYGIKSATTAKENRNAAFETLFEAAAGMIKETNRYTNEAEEAEMAFA LGLMDNTHDLQIAQQKANLALQYTIAVRNQVLDAYKEIMNLQF NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggatattacaagtataggtagtttaaatgagcttagtaagtatggcataaaatcagcc actacagccaaggaaaatcgaaacgcagctttcgagacattgtttgaagcggcagcgggt atgataaaagaaactaatcgttataccaatgaagcggaggaagcagagatggcctttgcc ctcggtcttatggataatacccatgatttgcagatagcacagcagaaagctaacttggca ttgcaatacacaattgcagtccgaaatcaggttttagatgcatataaagaaataatgaat ctgcaattttaa

DBGET integrated database retrieval system