Herbaspirillum seropedicae SmR1: Hsero_1926 Help Entry Hsero_1926        CDS       T01268                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hse  Herbaspirillum seropedicae SmR1 Pathway hse01100   Metabolic pathways hse01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hse00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Hsero_1926 (acpP)    00074 Mycolic acid biosynthesis     Hsero_1926 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Hsero_1926 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 MAP DUF1493 Motif Other DBs NCBI-ProteinID:  ADJ63434 UniProt:  D8IS90 LinkDB All DBs Position 2183562..2183801 Genome browser AA seq 79 aa AA seqDB search MSDIEQRVKKIVAEQLGVAEADIKNESSFVDDLGADSLDTVELVMALEDEFEMEIPDEQA EKITTVQQAIDYAKSQVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtccgatatcgaacaacgcgtgaagaagatcgtcgctgagcaactgggcgtcgccgaa gccgacatcaagaacgaatcgtcgttcgtggacgacctgggcgccgactcgctggacacc gtcgagctggtcatggcgctggaagatgagttcgaaatggaaatccccgacgaacaagcc gaaaagatcaccaccgtgcaacaggcgatcgattacgccaagtcgcaagtcaaggcctga

DBGET integrated database retrieval system