Herbaspirillum seropedicae SmR1: Hsero_2948 Help Entry Hsero_2948        CDS       T01268                                  Symbol hfq Name (GenBank) RNA chaperone Hfq protein   KO K03666   host factor-I protein Organism hse  Herbaspirillum seropedicae SmR1 Pathway hse02024   Quorum sensing hse03018   RNA degradation Brite KEGG Orthology (KO) [BR:hse00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     Hsero_2948 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Hsero_2948 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hse03019]     Hsero_2948 (hfq)    03036 Chromosome and associated proteins [BR:hse03036]     Hsero_2948 (hfq) Messenger RNA biogenesis [BR:hse03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      Hsero_2948 (hfq) Chromosome and associated proteins [BR:hse03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     Hsero_2948 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  ADJ64436 UniProt:  D8IZU6 Structure PDBPDBj LinkDB All DBs Position complement(3354917..3355156) Genome browser AA seq 79 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGHVESFDQYVVLLRNTVTQMVYKHAI STVVPARAVNLSLESSSDE NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaattgttacaagacccatttctgaacgcattgagaaaagagcac gttcccgtctctatctacctggtcaacggcatcaagctgcaaggccatgtggagtctttc gatcaatacgtggtcctgctgcgtaacaccgttacgcaaatggtttacaaacacgccatc tctaccgtcgtgcctgcacgtgcggtcaacctcagtctcgaatcctcgtccgacgaataa

DBGET integrated database retrieval system