Herbaspirillum seropedicae SmR1: Hsero_3704 Help Entry Hsero_3704        CDS       T01268                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hse  Herbaspirillum seropedicae SmR1 Pathway hse01100   Metabolic pathways hse01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hse00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Hsero_3704    00074 Mycolic acid biosynthesis     Hsero_3704   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Hsero_3704 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Motif Other DBs NCBI-ProteinID:  ADJ65182 UniProt:  D8IR56 LinkDB All DBs Position 4242018..4242296 Genome browser AA seq 92 aa AA seqDB search MTTLTPDMTKDEITVWIVDMLHEMFEIDKAAITPQSNLYTDLDIDSIDAVDIVVKLNQTT GKRIQPDVFRSVRTVQDVVEILATLMREQAHA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaccactctgacacctgacatgaccaaggacgaaatcaccgtgtggatcgtcgatatg ctgcacgagatgttcgagatcgacaaagcggccatcacgccccagtccaacctctacacc gatctcgacatcgacagcatcgacgccgtcgacatcgtggtcaagctcaaccagaccacc ggcaagcgcatccagcccgacgtcttccgcagcgtgcgcacggtgcaggacgtcgtcgag atcctggcgaccctgatgcgcgaacaagcgcacgcgtga

DBGET integrated database retrieval system