Herbaspirillum seropedicae SmR1: Hsero_4209 Help Entry Hsero_4209        CDS       T01268                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hse  Herbaspirillum seropedicae SmR1 Pathway hse01100   Metabolic pathways hse01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hse00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Hsero_4209 (acpP)    00074 Mycolic acid biosynthesis     Hsero_4209 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Hsero_4209 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADJ65678 UniProt:  D8IUE6 LinkDB All DBs Position 4813636..4813863 Genome browser AA seq 75 aa AA seqDB search MVTTETIINIIKESGLAQDISAFDPEKTFKQNGIDSLDVFTVLLTIEEQLNVKFSEQESN EIRSAADIVKLINSR NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggtaaccactgaaaccatcatcaacatcatcaaagagtcgggcctggcccaggatatt tcggcctttgatcccgaaaagacgttcaagcagaacggcattgattccctcgatgtattc acggtgctgctgacgatcgaggaacaattgaacgtcaagttctccgaacaagagtccaac gaaatccgtagcgcggccgatatcgtcaaactcatcaactcgcgttga

DBGET integrated database retrieval system