Haemophilus seminalis: L3077_04425 Help Entry L3077_04425       CDS       T08114                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hsem  Haemophilus seminalis Pathway hsem01100   Metabolic pathways hsem01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hsem00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     L3077_04425 (acpP)    00074 Mycolic acid biosynthesis     L3077_04425 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     L3077_04425 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 DUF1896 Motif Other DBs NCBI-ProteinID:  UJZ90729 LinkDB All DBs Position 891641..891871 Genome browser AA seq 76 aa AA seqDB search MSIEERVKKIIVEQLGVKEEDVKSEASFVEDLGADSLDTVELVMALEEEFDIEIPDEEAE KITTVQSAIDYVQNNQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtattgaagaacgcgtgaaaaaaatcatcgttgaacaattaggtgttaaagaagaa gatgttaaatctgaagcttctttcgttgaagatttaggtgcggactctttagacacagtt gaattagtaatggctttagaagaagaattcgatatcgaaattccagatgaagaagctgaa aaaatcacaactgttcaatctgcgattgactacgtgcaaaacaatcaataa

DBGET integrated database retrieval system