Halomonas aestuarii: BOX17_01540 Help Entry BOX17_01540       CDS       T04554                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hsi  Halomonas aestuarii Pathway hsi01100   Metabolic pathways hsi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hsi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BOX17_01540    00074 Mycolic acid biosynthesis     BOX17_01540   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BOX17_01540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  APE29756 UniProt:  A0A1J0VCL1 LinkDB All DBs Position complement(353185..353418) Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtgaagaaggttgtagccgagcgtctgaacgtcaaggaa gaagacatccagaactcctcttccttcaccgaggatctcggcgccgattccctggatacc gtcgagctggtgatggcgctcgaagaggagttcgacaccgagattcccgacgaggaagcc gagaagatcaccaccgttcaggaagccatcgactacgtcaacgcccaccagtaa

DBGET integrated database retrieval system