Haloarcula marismortui ATCC 33800: KDQ40_09680 Help Entry KDQ40_09680       CDS       T07272                                  Name (GenBank) acc operon protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism hsin  Haloarcula marismortui ATCC 33800 Pathway hsin00280   Valine, leucine and isoleucine degradation hsin00630   Glyoxylate and dicarboxylate metabolism hsin00640   Propanoate metabolism hsin01100   Metabolic pathways hsin01110   Biosynthesis of secondary metabolites hsin01120   Microbial metabolism in diverse environments hsin01200   Carbon metabolism Module hsin_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:hsin00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     KDQ40_09680    00640 Propanoate metabolism     KDQ40_09680   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     KDQ40_09680 Enzymes [BR:hsin01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      KDQ40_09680     6.4.1.3  propionyl-CoA carboxylase      KDQ40_09680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QUJ70995 UniProt:  M0JUL6 LinkDB All DBs Position 1895606..1895911 Genome browser AA seq 101 aa AA seqDB search MAADTDSAVDADLVAEIAAQLDDASTAEAAAIAVAIGAHLTDRQRAAAAAAAAAAADDGD SWDGRQWSFSGRVEATQKRSVRVRSDAPTDPWSAAGRAERF NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcggctgacactgactcggctgtcgatgcagatctggtcgcagaaatcgccgcccaa ctcgacgacgcgtcgacggccgaagcggctgctatcgccgtcgctatcggcgcacacctc accgaccgccagcgtgcggcagcagcggccgcggcggctgcggcggcagacgacggtgac tcctgggacggcagacagtggtcgttctccgggcgcgttgaagccacgcagaagcggtcc gttcgggttcgctcggacgcgccgaccgacccctggagcgctgccggccgcgccgaacgg ttctaa

DBGET integrated database retrieval system