Haloarcula marismortui ATCC 33800: KDQ40_12715 Help Entry KDQ40_12715       CDS       T07272                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hsin  Haloarcula marismortui ATCC 33800 Pathway hsin03010   Ribosome Brite KEGG Orthology (KO) [BR:hsin00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     KDQ40_12715   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     KDQ40_12715  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hsin03011]     KDQ40_12715    04121 Ubiquitin system [BR:hsin04121]     KDQ40_12715 Ribosome [BR:hsin03011]  Ribosomal proteins   Eukaryotes    Large subunit     KDQ40_12715   Archaea     KDQ40_12715 Ubiquitin system [BR:hsin04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    KDQ40_12715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 DHHC Toxin_5 Motif Other DBs NCBI-ProteinID:  QUJ71548 UniProt:  M0K108 LinkDB All DBs Position complement(2464482..2464631) Genome browser AA seq 49 aa AA seqDB search MASFETASDRLLNKQICMRCNARNPQRAQQCRKCGYGNLRPKAKETRSA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggctagcttcgagacagcgtccgaccgactcctcaacaagcagatctgcatgcggtgt aacgctcggaacccacagcgcgcccagcagtgccggaaatgtggctacggcaacctgcgt ccgaaggcgaaagaaacccgcagcgcctga

DBGET integrated database retrieval system