Hydrocurvibacter sulfurireducens: WCY03_00025 Help Entry WCY03_00025       CDS       T11236                                  Symbol queF Name (GenBank) preQ(1) synthase   KO K09457   7-cyano-7-deazaguanine reductase [EC:1.7.1.13] Organism hsj  Hydrocurvibacter sulfurireducens Pathway hsj00790   Folate biosynthesis hsj01100   Metabolic pathways Module hsj_M00988   PreQ1 biosynthesis, GTP => 7-Aminomethyl-7-deazaguanine Brite KEGG Orthology (KO) [BR:hsj00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     WCY03_00025 (queF)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:hsj03016]     WCY03_00025 (queF) Enzymes [BR:hsj01000]  1. Oxidoreductases   1.7  Acting on other nitrogenous compounds as donors    1.7.1  With NAD+ or NADP+ as acceptor     1.7.1.13  preQ1 synthase      WCY03_00025 (queF) Transfer RNA biogenesis [BR:hsj03016]  Prokaryotic type   tRNA modification factors    Other tRNA modification factors     WCY03_00025 (queF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  QueF GTP_cyclohydroI QueF_N Motif Other DBs NCBI-ProteinID:  XAU09969 LinkDB All DBs Position 6466..6849 Genome browser AA seq 127 aa AA seqDB search MKYGEKIVTEFDIEKDIEIWPNEHKRDYLIKMTLPEFSCLCPRSGYPDYATIYIEYTPND WVIELKAIKLYINSFRNRYISHENGANEIYELLQTKLKPKYLKIIADYNPRGNVHTVIEI DSSKVEL NT seq 384 nt NT seq  +upstreamnt  +downstreamnt ttgaaatacggtgaaaagatagtaacggagtttgatatcgagaaggatattgagatatgg ccaaatgagcataaacgcgattatctcatcaaaatgacgcttccggagtttagctgcttg tgtccaagaagcggatacccggattatgcgacgatctatatagaatatactccaaacgac tgggtcatagaattaaaagccataaaactgtatataaattcgtttagaaacagatatatt tcacatgaaaacggcgcaaacgaaatatatgaacttttacagacgaaactaaaaccgaaa tatcttaaaattattgccgattataatccgagaggaaatgttcatacggtaattgagata gatagttccaaagtggagctgtga

DBGET integrated database retrieval system