Hydrocurvibacter sulfurireducens: WCY03_01245
Help
Entry
WCY03_01245 CDS
T11236
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
hsj Hydrocurvibacter sulfurireducens
Pathway
hsj03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
hsj00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
WCY03_01245 (rplR)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
hsj03011
]
WCY03_01245 (rplR)
Ribosome [BR:
hsj03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
WCY03_01245 (rplR)
Bacteria
WCY03_01245 (rplR)
Archaea
WCY03_01245 (rplR)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Hfq
Motif
Other DBs
NCBI-ProteinID:
XAU10202
LinkDB
All DBs
Position
233561..233917
Genome browser
AA seq
118 aa
AA seq
DB search
MNAKVMKQKLAKRIQRKRRIRSKISGNTTLPRVSVFRSNRYLSAQAIDDTNSTTLAAIHS
KANGLRANKDGAAALGAAFAETLKKAGITTIVFDRNGYQYHGVVAAFGEALRANEIKF
NT seq
357 nt
NT seq
+upstream
nt +downstream
nt
atgaatgctaaagttatgaaacagaaattggcaaaacgtattcaacgtaagcgccgtatt
cgttcaaagatatctggcaacactacacttcctcgtgtttctgtgttccgttcaaacaga
tatttgagtgcacaggctattgacgatacgaattcgacgacactggcggctattcactca
aaagcaaatggtcttcgtgcaaacaaagacggtgctgccgcattaggtgctgcattcgct
gagacacttaaaaaagccggtatcactacaattgttttcgatcgtaacggttaccaatat
cacggtgttgtagctgcgtttggtgaagcacttcgtgcaaacgaaattaagttctag
DBGET
integrated database retrieval system