Hydrocurvibacter sulfurireducens: WCY03_09835 Help Entry WCY03_09835       CDS       T11236                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hsj  Hydrocurvibacter sulfurireducens Pathway hsj01100   Metabolic pathways hsj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hsj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WCY03_09835 (acpP)    00074 Mycolic acid biosynthesis     WCY03_09835 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WCY03_09835 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 Ribosomal_L12_N DUF5783 PRD Motif Other DBs NCBI-ProteinID:  XAU09654 LinkDB All DBs Position complement(1936312..1936539) Genome browser AA seq 75 aa AA seqDB search MALIDDIKEVVVEQLSVNPDEVKEDSKFVEDLGADSLDVVELVMALEEKFDIEIPDDEAE KIQTVKDVIDYIESK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcactaatcgatgatattaaagaagttgttgttgaacaattaagcgttaacccagac gaagtaaaagaagattctaaatttgtcgaggatctaggtgcggacagccttgatgtcgtt gaattagtaatggcgcttgaagagaagttcgatatcgaaatccctgatgacgaagcggaa aaaattcagactgtcaaagatgtaattgattatatagaaagtaaataa

DBGET integrated database retrieval system