Halobacterium salinarum R1: OE_2784R Help Entry OE_2784R          CDS       T00662                                  Symbol aroQ Name (GenBank) chorismate mutase   KO K04093   chorismate mutase [EC:5.4.99.5] Organism hsl  Halobacterium salinarum R1 Pathway hsl00400   Phenylalanine, tyrosine and tryptophan biosynthesis hsl01100   Metabolic pathways hsl01110   Biosynthesis of secondary metabolites hsl01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:hsl00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     OE_2784R (aroQ) Enzymes [BR:hsl01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      OE_2784R (aroQ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 DUF4025 Motif Other DBs NCBI-ProteinID:  CAP13884 UniProt:  B0R568 LinkDB All DBs Position complement(928132..928398) Genome browser AA seq 88 aa AA seqDB search MTLDELRAEIESIDREIVDLIARRTYVAETIADVKAEQGLSTTDESQEDAVMERAGENAA AFGVDDNLVKAVFRLLIELNKIEQRETR NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgacattggacgaactccgcgcggagatcgagagcatcgaccgcgagatcgtggatctg atcgcgcgacgcacgtacgtcgccgagaccatcgccgacgtgaaagccgagcaggggctg tcgacgaccgacgagtcccaggaggacgcagtgatggagcgcgccggcgagaacgccgcg gcgttcggcgtcgacgacaacctcgtgaaggcggtgttccggctgctcatcgagttgaac aaaatcgagcagcgggagacgcggtag

DBGET integrated database retrieval system