Halobacterium salinarum R1: OE_3868R Help Entry OE_3868R          CDS       T00662                                  Symbol rps31e Name (GenBank) 30S ribosomal protein S31e   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hsl  Halobacterium salinarum R1 Pathway hsl03010   Ribosome Brite KEGG Orthology (KO) [BR:hsl00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     OE_3868R (rps31e)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     OE_3868R (rps31e)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hsl03011]     OE_3868R (rps31e)    04121 Ubiquitin system [BR:hsl04121]     OE_3868R (rps31e)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsl04147]     OE_3868R (rps31e) Ribosome [BR:hsl03011]  Ribosomal proteins   Eukaryotes    Small subunit     OE_3868R (rps31e)   Archaea     OE_3868R (rps31e) Ubiquitin system [BR:hsl04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    OE_3868R (rps31e) Exosome [BR:hsl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    OE_3868R (rps31e)   Exosomal proteins of colorectal cancer cells    OE_3868R (rps31e) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_19 Ribosomal_L37e Zn_ribbon_RPB9 Zn_Ribbon_TF Prok-RING_1 DZR_2 zf-FPG_IleRS FYVE DZR Zn_ribbon_3 Cas12f1-like_TNB zf-C2H2_FBX41 zf_UBZ Motif Other DBs NCBI-ProteinID:  CAP14500 UniProt:  B0R6Y1 LinkDB All DBs Position complement(1497675..1497809) Genome browser AA seq 44 aa AA seqDB search MARGDYYSDDGTTDKEMCPRCGDTFLAAHDDRQVCGRCGYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcggtgactactacagcgacgacggcacgacggacaaggagatgtgcccgcgc tgcggggacacgttcctcgcggcccacgacgaccgccaggtgtgtgggcgctgcgggtac accgagtgggagtaa

DBGET integrated database retrieval system