Histophilus somni 2336: HSM_0035 Help Entry HSM_0035          CDS       T00673                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hsm  Histophilus somni 2336 Pathway hsm01100   Metabolic pathways hsm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hsm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HSM_0035    00074 Mycolic acid biosynthesis     HSM_0035   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HSM_0035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  ACA31985 UniProt:  B0UUZ3 LinkDB All DBs Position 27948..28178 Genome browser AA seq 76 aa AA seqDB search MSIEERVKKIIVEQLGVKEDDVKPEASFIEDLGADSLDTVELVMALEEEFDIEIPDEEAE KITTVQSAIDYVQNNQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagcattgaagaacgtgtaaaaaaaatcattgttgaacaattaggcgttaaagaagat gatgttaagcctgaagcttcatttattgaagatttaggtgcagattctttggatacagtt gaattagtaatggctttagaggaagaatttgatattgaaattccggatgaagaagctgag aaaattacaacagttcaatcagcaattgattatgttcaaaataatcaatag

DBGET integrated database retrieval system