Histophilus somni 2336: HSM_1996 Help Entry HSM_1996          CDS       T00673                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hsm  Histophilus somni 2336 Pathway hsm01100   Metabolic pathways hsm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hsm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HSM_1996    00074 Mycolic acid biosynthesis     HSM_1996   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HSM_1996 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ACA31794 LinkDB All DBs Position 2243487..2243744 Genome browser AA seq 85 aa AA seqDB search MELELQLKQLIIDSLALEDIGVEDIDTDAPLFGDEGLGLDSVDALELGLAVQKTFGLQLD SEQQNLRNHFESVATLASFIQSQKQ NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaacttgaattacaacttaaacaattaattattgacagccttgcacttgaggatatt ggtgttgaggatattgacactgatgcaccattatttggtgatgaggggttgggactggat tcggtggatgcgttagagctgggattggcagtccaaaaaacgtttggtttacaattggat agcgaacaacaaaacttgcgtaatcattttgaaagtgtggcgactttagcaagttttatt caaagtcagaaacagtag

DBGET integrated database retrieval system