Halapricum salinum: DV733_05240 Help Entry DV733_05240       CDS       T05943                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hsn  Halapricum salinum Pathway hsn03010   Ribosome Brite KEGG Orthology (KO) [BR:hsn00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     DV733_05240   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     DV733_05240  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hsn03011]     DV733_05240    04121 Ubiquitin system [BR:hsn04121]     DV733_05240   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsn04147]     DV733_05240 Ribosome [BR:hsn03011]  Ribosomal proteins   Eukaryotes    Small subunit     DV733_05240   Archaea     DV733_05240 Ubiquitin system [BR:hsn04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    DV733_05240 Exosome [BR:hsn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    DV733_05240   Exosomal proteins of colorectal cancer cells    DV733_05240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Rcat_RNF216 Zn_Ribbon_TF Cas12f1-like_TNB Zn_ribbon_RPAB4 Zn_ribbon_Nudix Zn_ribbon_RPB9 Ribosomal_L37e zf-C2H2_FBX41 TackOD1 Zn_ribbon_IS1595 Zn_ribbon_3 Zn_ribbon_19 DUF5817 zf-C2H2_ZN142 zf_UBZ HypA Motif Other DBs NCBI-ProteinID:  QCC50684 UniProt:  A0A4D6H9E2 LinkDB All DBs Position complement(1053005..1053139) Genome browser AA seq 44 aa AA seqDB search MPRHELYNDDGTSDREQCPRCGDSFLADHGDRLHCGKCGYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgccccgacacgaactctacaacgacgacggcaccagcgaccgcgaacagtgtccccgc tgtggcgactcgttcctcgccgaccacggcgaccgcctgcactgtggaaagtgcggctat accgagtgggaatag

DBGET integrated database retrieval system