Histophilus somni 129PT: HS_0112 Help Entry HS_0112           CDS       T00386                                  Symbol acp Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hso  Histophilus somni 129PT Pathway hso01100   Metabolic pathways hso01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hso00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HS_0112 (acp)    00074 Mycolic acid biosynthesis     HS_0112 (acp)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HS_0112 (acp) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 DUF1493 Retrotran_gag_4 Motif Other DBs NCBI-ProteinID:  ABI24390 UniProt:  Q0I112 LinkDB All DBs Position 101826..102074 Genome browser AA seq 82 aa AA seqDB search MTEQEIQKVLTEALVSLFEIDADKIKPETNLYQDLEIDSIDAIDLIDYIKRQTGYKLKAE DFRNVRTVSDVIAAVQKISENA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacagaacaggaaattcaaaaggtgttgacggaagccttagtttcattatttgaaatt gatgcggacaaaattaagcctgaaacaaatttataccaagatttagaaattgacagcatt gatgcgattgatttaattgactatatcaaacgccaaaccggttataaattaaaggcggaa gatttccgcaatgtgcgtaccgtaagtgatgttattgctgcggttcaaaaaatcagcgaa aacgcatag

DBGET integrated database retrieval system