Hyla sarda (Sardinian treefrog): 130358516 Help Entry 130358516         CDS       T11475                                  Symbol HMGB1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism hsq  Hyla sarda (Sardinian treefrog) Pathway hsq03410   Base excision repair hsq04140   Autophagy - animal hsq04217   Necroptosis Brite KEGG Orthology (KO) [BR:hsq00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     130358516 (HMGB1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130358516 (HMGB1)   09143 Cell growth and death    04217 Necroptosis     130358516 (HMGB1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hsq03036]     130358516 (HMGB1)    03400 DNA repair and recombination proteins [BR:hsq03400]     130358516 (HMGB1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsq04147]     130358516 (HMGB1) Chromosome and associated proteins [BR:hsq03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     130358516 (HMGB1) DNA repair and recombination proteins [BR:hsq03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      130358516 (HMGB1)    MMR (mismatch excision repair)     Other MMR factors      130358516 (HMGB1) Exosome [BR:hsq04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    130358516 (HMGB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 DUF4023 NOA36 Motif Other DBs NCBI-GeneID:  130358516 NCBI-ProteinID:  XP_056417827 LinkDB All DBs Position 2:complement(56992805..57009509) Genome browser AA seq 210 aa AA seqDB search MGKGDPKKPRGKMSSYAYFVQTCREEHKKKHPDASVNFAEFSKKCSERWKTMSAKEKGKF EDMAKADKVRYESEMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEFRPKIKGEHPGA TIGDVAKKLGEMWNNTSSEDKVPYEKKASKLKEKYKKDMASYRSKGKPEPAKKAPAKPEK SKRAEDDDDDEEDEDEEEEEEEEDEEEDDE NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atggggaaaggtgatcccaagaagcccagaggaaaaatgtcctcctatgcttactttgtg cagacgtgcagagaagagcacaagaagaagcatcctgatgcatctgtaaactttgcagaa ttctccaagaaatgctcagaacggtggaagactatgtctgctaaagaaaaaggaaagttt gaagatatggcaaaagcagacaaggtgcgctatgaaagtgaaatgaaaacttatatacca cccaaaggagaaacaaaaaagaagtttaaggacccaaatgcaccaaagagaccaccttcg gctttcttcttgttttgctccgagttccgtccgaaaatcaaaggagagcacccaggtgcg accattggagatgtcgcaaagaaactaggagagatgtggaataacacatcttcagaagac aaggtgccttatgaaaaaaaagcttccaaactgaaggagaagtacaagaaggatatggca tcatatcgatcaaaaggcaaaccagaacctgccaaaaaggctcctgctaagcctgagaaa agcaagagagcagaggatgatgatgacgatgaggaggatgaagatgaggaggaggaagag gaagaagaggatgaggaggaagatgatgaatga

DBGET integrated database retrieval system