Vreelandella sulfidaeris: HSBAA_06780 Help Entry HSBAA_06780       CDS       T06264                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism hsr  Vreelandella sulfidaeris Brite KEGG Orthology (KO) [BR:hsr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hsr03036]     HSBAA_06780 Chromosome and associated proteins [BR:hsr03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HSBAA_06780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Nuf2_DHR10-like YabA XRCC4_CC TolA_bind_tri Tup_N GAS DUF7310 FlaC_arch DivIC Motif Other DBs NCBI-ProteinID:  BBI59372 UniProt:  A0A365TTW8 LinkDB All DBs Position complement(429261..429455) Genome browser AA seq 64 aa AA seqDB search MSLELFNQLEQKVTDTVDALEMMKLENEELRGENAKLKEEREEWERRLNGLLSKFESLET SSTS NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgagcctggaactctttaatcagcttgaacagaaagtcactgataccgttgacgcgctg gaaatgatgaaactggaaaatgaagagctacgcggtgaaaacgccaagctcaaagaggag cgtgaagagtgggagcgtcgcctcaatggcctactaagcaaatttgagagcctggaaacc tccagcacgtcctaa

DBGET integrated database retrieval system