Vreelandella sulfidaeris: HSBAA_19100 Help Entry HSBAA_19100       CDS       T06264                                  Name (GenBank) hypothetical protein   KO K03503   DNA polymerase V [EC:3.4.21.-] Organism hsr  Vreelandella sulfidaeris Brite KEGG Orthology (KO) [BR:hsr00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:hsr01002]     HSBAA_19100   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:hsr03400]     HSBAA_19100 Peptidases and inhibitors [BR:hsr01002]  Serine peptidases   Family S24: LexA family    HSBAA_19100 DNA repair and recombination proteins [BR:hsr03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Y-family DNA polymerases     HSBAA_19100 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_S24 Thermo-DBP Motif Other DBs NCBI-ProteinID:  BBI60604 UniProt:  A0A455UBJ4 LinkDB All DBs Position complement(1198826..1199107) Genome browser AA seq 93 aa AA seqDB search MEGWGIFEGDLLIVDRGIEPRLGHILVAMLEGEALIKRYALYQGTPHLCSTHPHYPPVPL EGSDCQLWVWCVPWCTSTYVELRKSDDRISRRQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaaggctggggtatttttgagggtgatttactcatcgttgaccgtggtattgagccg cgcctgggccatattttggtcgcgatgctggaaggcgaagcgctgattaaacgctacgca ctttaccagggcaccccacatctatgttcaacccatccgcactacccgcccgttcctctt gagggcagcgactgccaattatgggtgtggtgcgtgccgtggtgcacgagtacttacgtt gagctaaggaagagtgatgatcggattagtcgacgccaataa

DBGET integrated database retrieval system