Vreelandella sulfidaeris: HSBAA_59540 Help Entry HSBAA_59540       CDS       T06264                                  Name (GenBank) hypothetical protein   KO K00245   succinate dehydrogenase iron-sulfur subunit [EC:1.3.5.1] Organism hsr  Vreelandella sulfidaeris Pathway hsr00020   Citrate cycle (TCA cycle) hsr00190   Oxidative phosphorylation hsr00620   Pyruvate metabolism hsr00650   Butanoate metabolism hsr00720   Other carbon fixation pathways hsr01100   Metabolic pathways hsr01110   Biosynthesis of secondary metabolites hsr01120   Microbial metabolism in diverse environments hsr01200   Carbon metabolism hsr02020   Two-component system Module hsr_M00009   Citrate cycle (TCA cycle, Krebs cycle) hsr_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate hsr_M00150   Fumarate reductase, prokaryotes hsr_M00982   Methylcitrate cycle Brite KEGG Orthology (KO) [BR:hsr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     HSBAA_59540    00620 Pyruvate metabolism     HSBAA_59540    00650 Butanoate metabolism     HSBAA_59540   09102 Energy metabolism    00190 Oxidative phosphorylation     HSBAA_59540    00720 Other carbon fixation pathways     HSBAA_59540  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     HSBAA_59540 Enzymes [BR:hsr01000]  1. Oxidoreductases   1.3  Acting on the CH-CH group of donors    1.3.5  With a quinone or related compound as acceptor     1.3.5.1  succinate dehydrogenase      HSBAA_59540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_17 Fer4 Fer2_3 Fer4_8 Fer4_10 Fer4_2 Fer4_9 Fer4_4 Fer4_7 Fer4_21 Fer4_6 Fer4_16 Fer4_3 Fer4_18 Fer4_13 ATP_sub_h Motif Other DBs NCBI-ProteinID:  BBI64648 UniProt:  A0A455UJV7 LinkDB All DBs Position complement(3732256..3732627) Genome browser AA seq 123 aa AA seqDB search MRDYDGDIRIEPLSHFPVQRDLVMDMEIFLEHLAAVKPYLIDDNPVKSYDPQAPETYQQS PEQLARYKQFANCINCGLCYSACPQFGLNPEFLGPAALTLAHRYNLDSRDHGKKQRMAEL NRH NT seq 372 nt NT seq  +upstreamnt  +downstreamnt ttgcgtgattatgacggtgatatccgcatcgagccgctatcccacttccccgtacagcgg gatctggtgatggatatggaaatattccttgagcacttggccgcggttaagccctatttg atcgatgacaatccggtgaaatcttacgacccccaggcgccggaaacctatcaacagtcg cccgaacagctcgcccgctacaagcagttcgctaactgcattaattgtggcctttgctac tcggcttgcccgcagtttggacttaatcctgagttccttggcccggcggcgctgacgctg gcccaccgttacaacctggatagccgcgaccacggcaagaagcagcgcatggcggagctc aatcgccactga

DBGET integrated database retrieval system