KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105192012
Entry
105192012         CDS       T03918                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    105192012
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hst00199]
    105192012
Enzymes [BR:hst01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     105192012
Cytochrome P450 [BR:hst00199]
 Cytochrome P450, animal type
  CYP306 family
   105192012
SSDB
Motif
Pfam: p450 Rcd1
Other DBs
NCBI-GeneID: 105192012
NCBI-ProteinID: XP_011154165
LinkDB
Position
Unknown
AA seq 597 aa
MSSVESIAEQNLRCRSTKRLSFGSQTIRGSLSTIVDDAATFSPRPCRSSDRESPSTFLPV
ISVQAGRQTVRPHHLTIFTIIIRRFTDSASLSGGPFAVPPSSPPIMTLLVYITLGACFLI
LLYTLRKNRKTFRLPPGPPGIPFLGYLPWLDAKNPHLSLTNLARKYGAICGLRMGSVYTI
LLSDPRLVRQAFAKDAFAGRAPLYLTHGIMQGYGLICAEGDLWKDQRRFAAGCLRNLGMV
KFGFRRDKMEERILAVVNECLSKLSSRMADGGIDPLETLHHCMGNLMNDLVFGKIYEEDD
ETWRWLRHLQEEGVKHIGVAGPLNFLPFLRFLPRYGKMMESLIDGKLKSHRFYQTIIDEH
RARPNKTDSFLAAFDKEMRNKTDAGDAGYFTRPQFHHLLSDIFGAGVDTTLTTLRWFLLF
MAVYPDEQRKVSDELMGHLMGQRQPCLADRTVLIRLEAAISETQRLRSVTPVGIPHGTIQ
DTQIGDYDVPKGSMVIPLQWAIHTDPSYWHEPLSFKLERFIAQDGSLARPEAFLPFQTGK
RMCVGDELARMILFLFAARILHTFVISMPPDTHVDLDGECGITLVPKPHRLLFTARQ
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgtcgtccgtggagagtatcgcagaacaaaatcttcgctgccgcagcacgaagcggttg
tcatttggtagtcaaactatccggggatcactttcgacaatagtcgacgacgcggcgaca
tttagcccgagaccgtgccgctcgtcggatcgtgaatccccttcgacgttccttccagtt
atatccgttcaggcaggcaggcagaccgtgagacctcaccacctgactatctttacgatc
atcattcggcggtttacggattcggcgtcactttcaggcggccctttcgcggtcccccca
agctcacccccaatcatgacgctcctcgtatacatcaccctcggtgcgtgtttcctaatt
ctgctctacaccctccgcaaaaatcgcaagaccttccgactgcccccgggaccacccggc
atccccttcctcggctatttaccgtggttagacgcgaagaaccctcacttgtcgctgacg
aatctcgcgaggaagtacggagcgatctgcggactccgaatgggctcggtctacacgatc
ctgctgtcggatcctcggctggtgaggcaagccttcgctaaggacgcgttcgccggcagg
gctccgctctatttgacgcatgggattatgcaaggatacggcctcatttgcgccgaaggt
gacctctggaaggatcaaaggaggttcgcagccggatgcctgaggaatctcggcatggtg
aagttcggcttcaggagggacaagatggaggagaggatcctcgcggtcgtgaacgaatgc
ttatcgaaactaagtagccgcatggcggacggcggtatcgacccgctggagacgcttcat
cactgtatgggcaacttgatgaacgatctcgtgtttggcaaaatttacgaggaagacgac
gagacgtggaggtggctgcggcacttgcaggaggagggagtcaagcacatcggggtcgcc
gggccgttgaattttctgccgttcctcagatttttaccacgctacggcaaaatgatggag
tcgctaattgacggcaagttgaagtcgcatcgcttctaccaaacaatcatcgacgagcac
cgtgcgcgacccaacaagacggacagcttcctcgcggctttcgacaaggagatgaggaac
aagaccgacgcgggcgacgctgggtacttcactcggccgcagtttcatcatctgttgagc
gacatcttcggcgccggcgtcgacaccactctgacgactcttcgttggttcctgctcttc
atggcggtttacccggacgagcaaagaaaagtgtcggacgaactgatgggacatctgatg
ggacaaaggcagccttgtttggcagataggaccgttttaattcgactggaagccgccatt
tcagagacgcaaaggctgcgaagcgttacaccggttggcatccctcatggaacaattcag
gacacccaaataggcgactacgatgtaccgaaaggcagtatggttattccgttgcaatgg
gctattcacacggatccttcttactggcatgagccgctctcctttaaactcgagagattt
atcgcgcaagatgggagtctcgccaggccggaagcctttttgccttttcaaacgggtaaa
cgcatgtgcgtcggcgacgagctggccaggatgatactgttcctgttcgctgcgagaatc
ctccatacgttcgtcatctcgatgccgcccgacacgcacgtcgacctcgacggcgagtgc
ggcatcaccctggtgccgaagccgcatcgactgctttttacggcgcggcagtag

DBGET integrated database retrieval system