Halanaeroarchaeum sulfurireducens HSR2: HLASF_1981 Help Entry HLASF_1981        CDS       T03927                                  Symbol rps27AE Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hsu  Halanaeroarchaeum sulfurireducens HSR2 Pathway hsu03010   Ribosome Brite KEGG Orthology (KO) [BR:hsu00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HLASF_1981 (rps27AE)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HLASF_1981 (rps27AE)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hsu03011]     HLASF_1981 (rps27AE)    04121 Ubiquitin system [BR:hsu04121]     HLASF_1981 (rps27AE)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsu04147]     HLASF_1981 (rps27AE) Ribosome [BR:hsu03011]  Ribosomal proteins   Eukaryotes    Small subunit     HLASF_1981 (rps27AE)   Archaea     HLASF_1981 (rps27AE) Ubiquitin system [BR:hsu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HLASF_1981 (rps27AE) Exosome [BR:hsu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HLASF_1981 (rps27AE)   Exosomal proteins of colorectal cancer cells    HLASF_1981 (rps27AE) SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Rcat_RNF216 FYVE RUBY_RBDX DZR Zn_ribbon_RPB9 HypA Motif Other DBs NCBI-ProteinID:  AKH98448 UniProt:  A0A0F7PGM1 LinkDB All DBs Position complement(1898500..1898631) Genome browser AA seq 43 aa AA seqDB search MPRSDYYEDGEAVRERCPRCEDSFLADHDDRKHCGRCGYTEWK NT seq 132 nt NT seq  +upstreamnt  +downstreamnt atgccccgaagcgactactacgaggacggcgaggcggtgcgcgagcggtgtccccggtgt gaggactcgttcctcgcggaccacgacgaccgcaagcactgtggtcgctgtgggtatacc gagtggaagtaa

DBGET integrated database retrieval system