Halomonas sulfidivorans: HNO53_11390 Help Entry HNO53_11390       CDS       T08036                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism hsv  Halomonas sulfidivorans Brite KEGG Orthology (KO) [BR:hsv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hsv03036]     HNO53_11390    03400 DNA repair and recombination proteins [BR:hsv03400]     HNO53_11390 Chromosome and associated proteins [BR:hsv03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     HNO53_11390 DNA repair and recombination proteins [BR:hsv03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       HNO53_11390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS_N Utp13 FliE DUF6374 SPT2_N Kinesin_assoc DinB AT_hook SpoIIE_N DUF5401 Motif Other DBs NCBI-ProteinID:  QTP59261 LinkDB All DBs Position complement(2454782..2455072) Genome browser AA seq 96 aa AA seqDB search MSSETLERIARNKNVARAAARQLSMEQLHKLSDVIGEVIEQKNEEEKLRKQEEADKEKKL AEIREAMNDAGLSVEDLVGEQPRRRRGRPPKNASGS NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgtccagcgaaaccctggagcgtatcgcccgtaacaagaacgtggctcgtgctgcggcc cgccagttgagcatggaacagctgcacaagctgtccgatgtgatcggcgaggtcatcgag cagaaaaatgaagaggagaagctccgcaaacaggaagaagcggacaaggaaaagaaactg gctgagatccgcgaggccatgaatgatgccggtctctccgtggaagatctcgtaggggaa cagccgcgccgtcggcgtggtcgtccgcccaagaatgccagcggttcgtga

DBGET integrated database retrieval system