Hymenobacter swuensis: Hsw_2138
Help
Entry
Hsw_2138 CDS
T03055
Name
(GenBank) acetyl-CoA carboxylase
KO
K01961
acetyl-CoA carboxylase, biotin carboxylase subunit [EC:
6.4.1.2
6.3.4.14
]
Organism
hsw
Hymenobacter swuensis
Pathway
hsw00061
Fatty acid biosynthesis
hsw00620
Pyruvate metabolism
hsw00640
Propanoate metabolism
hsw00720
Other carbon fixation pathways
hsw01100
Metabolic pathways
hsw01110
Biosynthesis of secondary metabolites
hsw01120
Microbial metabolism in diverse environments
hsw01200
Carbon metabolism
hsw01212
Fatty acid metabolism
Module
hsw_M00082
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:
hsw00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00620 Pyruvate metabolism
Hsw_2138
00640 Propanoate metabolism
Hsw_2138
09102 Energy metabolism
00720 Other carbon fixation pathways
Hsw_2138
09103 Lipid metabolism
00061 Fatty acid biosynthesis
Hsw_2138
Enzymes [BR:
hsw01000
]
6. Ligases
6.3 Forming carbon-nitrogen bonds
6.3.4 Other carbon-nitrogen ligases
6.3.4.14 biotin carboxylase
Hsw_2138
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.2 acetyl-CoA carboxylase
Hsw_2138
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
Biotin_carb_C
Dala_Dala_lig_C
ATP-grasp
GARS_A
ATP-grasp_3
RimK
ATPgrasp_ST
ATP-grasp_4
ATP-grasp_5
SUI1
Motif
Other DBs
NCBI-ProteinID:
AHJ97733
UniProt:
W8EYQ6
LinkDB
All DBs
Position
complement(2431307..2432812)
Genome browser
AA seq
501 aa
AA seq
DB search
MKKITKLLVANRGEIALRVLRSAKEMGLQTVAIYSEADRNALHVRYADEAVCVGPPASKD
SYLRGDKILEVCKQLGVDAIHPGYGFLSENAEFARMVTEAGLIFVGPSPEAMNVMGDKLS
AKQAVKAYNIPLVPGTDEAISDVEEAKRIAATVGFPILIKASAGGGGKGMRIVNSAEDFE
EQMQLAINEATSAFGDGSVFIEKFVTGPRHIEIQVLGDEHGNIVHLFERECSIQRRHQKV
IEEAPSSVLTPELRAEMGRCAVDVARACNYTGAGTVEFLLDDQRNFYFLEMNTRLQVEHP
VTEQITGLDLVKEQIKVAQGLPLAFSQDDLTITGHALELRVYAEDPQNNFLPDIGTLTTY
VRPQGPGVRVDDGFEQGMEIPIYYDPMIAKLVTFGATREEAIARMLRAIDEYQITGIETT
LGFGRYVLQHPAFVSGNFDTNFIRDHFPADALKPAAPNEATAKLAAVLTAMLLMEKKPAT
PAADAPAATGSAWKRNRLGAR
NT seq
1506 nt
NT seq
+upstream
nt +downstream
nt
atgaaaaaaataaccaagctgctcgtcgccaaccgcggcgaaattgcgttgcgcgtgctg
cgctcggccaaggaaatgggcctccagaccgtagccatctactctgaagctgaccgcaat
gccctgcacgtgcgctacgccgacgaggccgtgtgcgtgggcccgcccgccagcaaagac
agctacctgcgcggcgacaaaatcctggaagtctgcaagcaattgggcgtcgatgccatt
caccccggctacggcttcctgagcgaaaacgccgagtttgcccgcatggtcacggaggcc
gggctgattttcgtgggtccttcgccggaagccatgaacgtgatgggcgacaagctttcg
gccaagcaggccgtgaaagcctacaacatcccgctggtgcccggcaccgacgaagccatt
tccgacgtggaagaggccaagcgcattgccgccacggtgggcttccccatcctgatcaag
gcctcggccggcggcggcggcaagggcatgcgcatcgtgaattcggccgaggattttgag
gagcagatgcagctggccatcaacgaggccacctcagccttcggcgacggctcggtgttc
attgagaagttcgtgaccggcccgcgccacatcgaaattcaggtcctgggcgacgagcac
ggcaacatcgtgcatctgtttgagcgggaatgctcgattcagcgccgccaccagaaggtg
attgaggaagcgccttcctcggtgctcacgcccgagctgcgcgccgaaatgggccgttgc
gccgtggacgtggcccgcgcctgcaactacaccggggccggcaccgtggagtttttgctg
gacgaccagcgcaacttctacttcctggagatgaacacccgcctgcaggtggagcacccc
gtgacggagcagattacgggcctcgacctggtgaaggagcagatcaaagtggcccagggc
ctgcccctggcctttagccaggacgacctgaccatcaccggccacgccctggagctgcgc
gtgtacgccgaggatccgcagaacaatttcctgcccgacatcgggacgctgaccacctac
gtgcgcccccagggccccggcgtgcgggtggatgacggcttcgagcaaggcatggaaatc
ccgatttactacgacccgatgattgccaagctcgtcaccttcggggccacccgcgaggag
gccattgcccggatgctgcgcgccatcgacgaataccagattaccggcatcgaaaccacg
ctgggcttcggccgctacgtgctgcagcacccggccttcgtgagcggcaacttcgacacc
aacttcatccgcgaccatttcccggccgacgccctgaaacctgccgcccccaatgaagcc
accgccaagcttgccgccgtcctcaccgccatgctcctgatggagaagaaacccgcaact
cccgccgccgatgcgcccgccgctaccggctcggcctggaaacgcaaccggctgggggct
cggtag
DBGET
integrated database retrieval system