Billgrantia sulfidoxydans: HNO51_07645 Help Entry HNO51_07645       CDS       T08035                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hsx  Billgrantia sulfidoxydans Pathway hsx01100   Metabolic pathways hsx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hsx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HNO51_07645 (acpP)    00074 Mycolic acid biosynthesis     HNO51_07645 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HNO51_07645 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  QTP54565 UniProt:  A0ABX7W333 LinkDB All DBs Position 1633375..1633608 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtgaagaaggttgtggccgagcgcctgaacgtcaaggaa gaggacatccagaacagctcctccttcaccgaggacctgggcgccgattccctggacacc gtcgagctggtcatggcgctcgaagaggaattcgataccgaaatccccgatgaagaagcc gagaagatcaccaccgttcaggaagccatcgattacgtcaacgcccaccagtaa

DBGET integrated database retrieval system