Billgrantia sulfidoxydans: HNO51_08700 Help Entry HNO51_08700       CDS       T08035                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hsx  Billgrantia sulfidoxydans Pathway hsx01100   Metabolic pathways hsx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hsx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HNO51_08700    00074 Mycolic acid biosynthesis     HNO51_08700   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HNO51_08700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QTP54752 UniProt:  A0ABX7W4Y6 LinkDB All DBs Position 1862361..1862612 Genome browser AA seq 83 aa AA seqDB search MNREELRTIVLEELSAIAPDIDIDHFDDRARLRDEYDLDSMDALNLLTAVHQRLGVNIPE SDYARMQNLQALLDYLETRVENC NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgaacagagaagaattgcgtaccatcgtgctcgaggagctttccgccattgcgccggat atcgatatcgaccacttcgatgaccgtgcccggctgcgtgacgaatacgatctcgattcc atggatgccctcaacctgctaaccgctgtacaccagcgtctgggcgtcaatatcccagag agcgattacgcacggatgcaaaacctccaagcgctgctggattatctggaaacgcgagtc gaaaactgttga

DBGET integrated database retrieval system