Hydractinia symbiolongicarpus: 130621213 Help Entry 130621213         CDS       T09218                                  Name (RefSeq) ADP-ribosylation factor 1-like 2   KO K07937   ADP-ribosylation factor 1/2 Organism hsy  Hydractinia symbiolongicarpus Pathway hsy04144   Endocytosis Brite KEGG Orthology (KO) [BR:hsy00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     130621213  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsy04131]     130621213   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsy04147]     130621213    04031 GTP-binding proteins [BR:hsy04031]     130621213 Membrane trafficking [BR:hsy04131]  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     130621213   Arf GTPases and associated proteins    Arf GTPases     130621213  Endosome - Golgi transport     130621213 Exosome [BR:hsy04147]  Exosomal proteins   Proteins found in most exosomes    130621213 GTP-binding proteins [BR:hsy04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     130621213 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Motif Other DBs NCBI-GeneID:  130621213 NCBI-ProteinID:  XP_057292510 LinkDB All DBs Position 12:8100759..8101661 Genome browser AA seq 105 aa AA seqDB search MQAIVCSYPSTANVLAKFLSSVELLWASLIYFLKAEIHGQFKMTGVFRHFKDLPNAMNAA EVTDKLGLHNIRNRSWYIQATCATSGDGLYEGLDWLSNELEKRKN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgcaagccatagtctgttcatatccttccacagcaaatgtgctagcaaaatttttatca tcagtagaactactctgggcatcactaatatactttctgaaggctgaaatacacggtcag tttaaaatgactggtgtttttcgtcattttaaagatttaccaaatgcaatgaatgctgct gaagtaactgataagttggggcttcacaatatacgaaaccgaagttggtacatccaagca acttgtgctacaagcggagatggtctatatgaaggacttgactggctttcaaatgaacta gagaagagaaagaactaa

DBGET integrated database retrieval system