Hydractinia symbiolongicarpus: 130649598 Help Entry 130649598         CDS       T09218                                  Name (RefSeq) ras-related protein Rac1-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism hsy  Hydractinia symbiolongicarpus Pathway hsy04145   Phagosome hsy04148   Efferocytosis hsy04310   Wnt signaling pathway hsy04620   Toll-like receptor signaling pathway hsy05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:hsy00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     130649598  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     130649598    04148 Efferocytosis     130649598  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     130649598  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     130649598  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsy04131]     130649598   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsy04147]     130649598    04031 GTP-binding proteins [BR:hsy04031]     130649598 Membrane trafficking [BR:hsy04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     130649598  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     130649598   Macropinocytosis    Ras GTPases     130649598  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     130649598 Exosome [BR:hsy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130649598   Exosomal proteins of other body fluids (saliva and urine)    130649598   Exosomal proteins of colorectal cancer cells    130649598   Exosomal proteins of bladder cancer cells    130649598 GTP-binding proteins [BR:hsy04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     130649598 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  130649598 NCBI-ProteinID:  XP_057311892 LinkDB All DBs Position 7:complement(18467563..18480318) Genome browser AA seq 199 aa AA seqDB search MSKEIKCVVVADIGVGRTTLLITYATKQFPTEYIPTVFDNYVVDVELKESEESARVGLME AANHFEEEERLRPLIYPQTDVFLICFSLSNQKSYEHVRTKWHPELKRYRPTAAIVLVGTK LDTRNDKEYAEKHEKEGRKIITTEEGIELAKKIGAVKYLECSALTQQGVNEVFDEVARAG LNVLKTTHTPTQRKKCTLL NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atgagcaaagaaataaaatgtgtagttgttgctgacataggcgttggaagaactaccttg cttataacgtatgcaactaaacagtttccaaccgaatatattcccactgtcttcgataat tacgtggtggatgtggaactgaaagagagtgaagaatcggcacgtgttggtttgatggaa gctgctaatcattttgaggaggaagaaagactgagacctctaatttatcctcaaacagat gtgtttttgatatgtttctcgttatcaaatcaaaaatcctatgaacacgtgcgtacaaaa tggcatccagaacttaaaagatatcgtcctactgcagctatcgtgttagttggtacaaaa cttgacacacgaaacgataaagagtatgctgagaaacatgaaaaagaagggagaaagata attacaacagaagaaggaatagaactagcgaaaaaaataggagctgtgaagtatttagaa tgttctgcattgacacaacaaggtgtaaatgaagtatttgatgaagtagctagagctggg ttaaatgttttgaaaacaactcatactccaactcaaagaaaaaaatgtacattgttataa

DBGET integrated database retrieval system