Hibiscus syriacus (Rose-of-Sharon): 120119133 Help Entry 120119133         CDS       T09559                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Brite KEGG Orthology (KO) [BR:hsyr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hsyr03036]     120119133   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsyr04147]     120119133 Chromosome and associated proteins [BR:hsyr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120119133 Exosome [BR:hsyr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120119133 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C TFIID-31kDa CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  120119133 NCBI-ProteinID:  XP_038994951 LinkDB All DBs Position Unknown AA seq 95 aa AA seqDB search MARTKQTARCRKSAPTTGGVKKPHRYRPGNCCTSRLVREIAQDFKSHAVLALQEAAEAYL VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcccgtaccaagcaaactgcccgctgccgaaagtctgcccccaccaccggaggtgtg aagaagcctcacagataccgtcctggaaactgttgcacttcgaggcttgttcgtgaaatt gcccaggatttcaagagtcatgctgtcctggctctccaggaagctgcagaggcatacctg gtgggtcttttcgaagacactaacttatgtgctatccatgccaagcgtgttacaatcatg cccaaggatatccagttggctcgcaggatcaggggcgagcgtgcctag

DBGET integrated database retrieval system