Hibiscus syriacus (Rose-of-Sharon): 120126201 Help Entry 120126201         CDS       T09559                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr03083   Polycomb repressive complex hsyr04120   Ubiquitin mediated proteolysis hsyr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:hsyr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120126201    04120 Ubiquitin mediated proteolysis     120126201   09126 Chromosome    03083 Polycomb repressive complex     120126201  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsyr04131]     120126201    04121 Ubiquitin system [BR:hsyr04121]     120126201    03036 Chromosome and associated proteins [BR:hsyr03036]     120126201 Membrane trafficking [BR:hsyr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     120126201 Ubiquitin system [BR:hsyr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      120126201    Cul7 complex      120126201 Chromosome and associated proteins [BR:hsyr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      120126201   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      120126201 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  120126201 NCBI-ProteinID:  XP_039000409 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MSSMGRIITLRSSDGENFEVDEAVALESQTTKHMIEDDCVGNGIPLPNVTSKIFSKVIEY CKKHVEAANSDDRSSSIDDELKSWDADFVKVYQATLFDLILLVYLTR NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgatgggtaggataatcacgttgaggagctcggacggcgaaaacttcgaggtg gacgaggctgtggcactcgaatcgcaaacgaccaagcacatgatcgaggacgattgcgtt ggaaacggcattcctttacccaacgtcaccagcaagatcttctctaaagttatcgagtac tgcaagaaacacgtggaagcagctaactccgacgatcgttcttcctccatcgacgatgag ctcaagtcttgggacgccgatttcgtcaaggtctatcaagccaccctcttcgatctaatc ctgcttgtgtacctgacgcgctaa

DBGET integrated database retrieval system