Hibiscus syriacus (Rose-of-Sharon): 120143526 Help Entry 120143526         CDS       T09559                                  Name (RefSeq) sm-like protein LSM5   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr03018   RNA degradation hsyr03040   Spliceosome Brite KEGG Orthology (KO) [BR:hsyr00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     120143526   09123 Folding, sorting and degradation    03018 RNA degradation     120143526  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hsyr03019]     120143526    03041 Spliceosome [BR:hsyr03041]     120143526 Messenger RNA biogenesis [BR:hsyr03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      120143526   mRNA degradation factors    5'-3' decay     Lsm complex      120143526 Spliceosome [BR:hsyr03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     120143526 SSDB OrthologParalogGFIT Motif Pfam:  LSM DUF7452 Ntox4 Motif Other DBs NCBI-GeneID:  120143526 NCBI-ProteinID:  XP_039013761 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MTNNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLRGFDVYVNMVLEDVTEYEITAEGR RITKLDQILLNGNNIAILVPGGSPDTE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacaaacaatccctcgcagcttcttccgtcagagttgatagataggtgcatagggtcc aaaatatgggtgataatgaaaggcgacaaggaactcgtgggtactctaagaggcttcgat gtctacgtcaatatggttctcgaagatgtcactgaatatgagatcactgctgaaggaaga cggatcacaaagcttgatcaaattttacttaatggaaacaacattgccattttggtcccg ggaggctcacctgatacagaataa

DBGET integrated database retrieval system