Hibiscus syriacus (Rose-of-Sharon): 120143675 Help Entry 120143675         CDS       T09559                                  Name (RefSeq) sm-like protein LSM2   KO K12621   U6 snRNA-associated Sm-like protein LSm2 Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr03018   RNA degradation hsyr03040   Spliceosome Brite KEGG Orthology (KO) [BR:hsyr00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     120143675   09123 Folding, sorting and degradation    03018 RNA degradation     120143675  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:hsyr03019]     120143675    03041 Spliceosome [BR:hsyr03041]     120143675 Messenger RNA biogenesis [BR:hsyr03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      120143675   mRNA degradation factors    5'-3' decay     Lsm complex      120143675 Spliceosome [BR:hsyr03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     120143675  Complex C   U2 snRNP components     120143675 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX DUF150_C DUF1256 Motif Other DBs NCBI-GeneID:  120143675 NCBI-ProteinID:  XP_039013864 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MLFFSYFKDLVGREVTVELKNDLAIRGTLHSVDQYLNIKLENTRVVDQDKYPHMLSVRNC FIRGSVVRYVQLPPDGVDIELLHDATRREARGG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgctgttcttttcgtatttcaaggacttagtgggaagagaagtgacggtggagctgaag aatgatttagcaattagaggaacccttcactccgttgatcaatacctcaatatcaagctc gagaacactagggttgtcgatcaagacaagtatcctcacatgctttcagtgaggaactgt tttatcagaggttcggttgtgagatatgtccagctacctccagatggagttgacattgaa ttgcttcacgatgccacgagaagagaagctcggggaggctga

DBGET integrated database retrieval system