KEGG   Hibiscus syriacus (Rose-of-Sharon): 120144004
Entry
120144004         CDS       T09559                                 
Name
(RefSeq) tubby-like F-box protein 7
  KO
K19600  tubby and related proteins
Organism
hsyr  Hibiscus syriacus (Rose-of-Sharon)
Brite
KEGG Orthology (KO) [BR:hsyr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsyr03037]
    120144004
   04990 Domain-containing proteins not elsewhere classified [BR:hsyr04990]
    120144004
Cilium and associated proteins [BR:hsyr03037]
 Primary cilia and associated proteins
  Other primary cilia associated proteins
   120144004
Domain-containing proteins not elsewhere classified [BR:hsyr04990]
 Other domain-containing proteins
  Tubby family proteins
   120144004
SSDB
Motif
Pfam: Tub F-box F-box-like
Other DBs
NCBI-GeneID: 120144004
NCBI-ProteinID: XP_039014112
LinkDB
Position
Unknown
AA seq 384 aa
MSPSSSFRKPSCLSRRFSGSWRSSSKTAALATVSPTANQPDLSSSSSSPAGEGRDSWSTL
LPELLGEIMERVEASEDRWPLRQNVVACACVCKKWREAMREIVRASSPGSGKITFSTCLK
QPGPSDIPNQCIIKRCKKNSTFYLYLSLTPSFTDKGKFLLAAKRYRHGAHIEYILSLDAD
DISQGSNAYAGKISSDFLGTNFTIFDSQPPHSGAKPSSSRSSRRFATKRISPQVPAGNFE
VGKVSYKFNLLKSRGPRRIICSVKCPLPEERTDKHLDDYEEKMPENAAPGHTILKNKAPR
WHEHLQCWCLNFHGRVTVASVKNFQLSAIVDPSQPGGKGNEETVLLQFGKVGDDTFTMDY
RYPLSPFLAFAICITSFGTKWACE
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgtcgccttcgtcgtcgttcaggaagccctcgtgcctttcacggagattctcgggatcg
tggagatcatcgtccaaaacggcggcgttagcaacggtctcgcccacggccaaccagccg
gatttgtcttcctcgtcttcgtctccggcgggggagggacgggattcctggtccacattg
ctgccggagttgttaggtgagatcatggagcgcgtggaggcgagtgaagatcggtggcct
ctgaggcaaaacgtcgtcgcatgcgcctgcgtatgtaagaagtggagagaagctatgaga
gagatcgttagggcttcttctcctggtagcggaaaaatcactttttctacatgtcttaaa
cagcctggtccaagtgatattccaaaccagtgtattataaagcggtgcaaaaagaactcg
acattctacctctatctttctcttacaccatcgttcaccgacaaggggaagtttctattg
gcagcaaaaagatatcgacatggtgctcatattgagtatattctatcccttgatgcagat
gatatatctcaaggtagcaatgcctatgctgggaagataagttcggattttttaggtacc
aactttacgatctttgatagtcagccaccccacagtggtgccaaaccttcgagcagtaga
tcaagtcgcagatttgcaactaagcgaatcagcccccaagttccagctggcaattttgag
gtgggaaaagtgtcttacaagttcaatctcttgaaatcaagaggtccgaggaggataatc
tgctctgtgaaatgccctttgccagaagaaaggaccgacaagcatttagatgactacgaa
gagaaaatgcccgagaatgctgcacccggtcatacaattttgaagaacaaagctccaaga
tggcatgaacatttacagtgttggtgtttgaatttccacggtcgggtaacagtagcatct
gtgaaaaactttcagctgtctgcgattgtagacccaagccaaccaggagggaaaggaaat
gaggaaacggttctcctccaatttgggaaagttggggatgatacattcaccatggattat
aggtatcccttgtcaccctttcttgcatttgccatctgcataacaagctttggtacgaaa
tgggcttgtgaatga

DBGET integrated database retrieval system