KEGG   Hibiscus syriacus (Rose-of-Sharon): 120144540
Entry
120144540         CDS       T09559                                 
Name
(RefSeq) nuclear transcription factor Y subunit C-9-like
  KO
K08066  nuclear transcription factor Y, gamma
Organism
hsyr  Hibiscus syriacus (Rose-of-Sharon)
Brite
KEGG Orthology (KO) [BR:hsyr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsyr03000]
    120144540
Transcription factors [BR:hsyr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Heteromeric CCAAT factors
    120144540
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF SusD-like_3 Peptidase_M7
Other DBs
NCBI-GeneID: 120144540
NCBI-ProteinID: XP_039014514
LinkDB
Position
Unknown
AA seq 259 aa
MDQQGHAQPPATKMMGSGAQVPYCTNPYQNQVTGAAQNPGTVVTSVGGIQSTPTVAQLAQ
HQLAYQQIHHQQQQLLQQQPQTFWANQYQEIEKVTDFKNHNLPLARIKKIMKADEDVRMI
SAEAPVIFARACEMFILELTLRSWNHTEENKRRTLQKNDIAAAIIRTDIFDFLVDIVPRE
DLKDEVLASIPRGTMPVGGPADALSYYMPAQHAPQVGTPGMIMGKLVVDPAIYAQQSHPY
MAQQMWPPGLEQQQSSSNH
NT seq 780 nt   +upstreamnt  +downstreamnt
atggatcagcaaggacatgcgcagcccccggctacgaagatgatgggtagcggagctcaa
gttccttactgtactaatccgtatcaaaatcaggtgactggggcggcccaaaatccaggg
acggttgtgacatcagtcggaggtattcagtccactccgacggttgcacaacttgcacag
caccaacttgcttatcagcaaatccaccaccagcagcaacagctacttcagcaacaaccc
cagacattttgggcaaatcagtatcaggaaatcgagaaagttacagatttcaagaaccat
aaccttcccttagcccggatcaagaagatcatgaaagccgatgaagatgtgaggatgata
tctgccgaggcccctgtcattttcgctcgggcatgtgaaatgttcatcttagaattgaca
ttgcgttcgtggaatcacacggaagagaataaaaggaggacacttcagaagaatgatatc
gctgcagcaattatcaggactgacatatttgatttcttagttgatatagttccgagagag
gatctgaaagatgaagttcttgcatcgattccacgtggaacaatgcctgtaggagggcct
gctgatgcattgtcttattacatgcctgcgcaacacgcacctcaggtcgggactccggga
atgataatggggaagctggtggtggaccctgctatctatgcccagcagtctcacccatac
atggcgcagcagatgtggccaccaggtctcgagcaacaacagtcttcatccaatcattag

DBGET integrated database retrieval system