Hibiscus syriacus (Rose-of-Sharon): 120155026 Help Entry 120155026         CDS       T09559                                  Name (RefSeq) protein MHF2 homolog   KO K15360   centromere protein X Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:hsyr00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     120155026  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:hsyr03400]     120155026 DNA repair and recombination proteins [BR:hsyr03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      120155026 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-X TAN Motif Other DBs NCBI-GeneID:  120155026 NCBI-ProteinID:  XP_039022545 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MDNNEAPTFEQDLIRAIFKHLWIKKAQERERNEFPNSEAVDSEVGAGTSKKNRPTSANAN ANALKQSCELLRVFVTEAVQRAGTIAEAEGSTKIEPTHLERILP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggacaacaacgaagctcccactttcgaacaggatttgattagagctattttcaagcat ctttggattaaaaaagctcaagagcgtgaaagaaacgaattcccaaacagcgaggctgta gattccgaggttggagcgggaacatcgaagaagaatcgacccacttctgctaatgctaat gcaaatgctttaaagcagagttgtgaacttcttcgggtttttgtcacagaggctgtccag cgagctggtacaattgctgaagctgagggtagcactaagattgaaccaactcacttagaa aggattcttccttaa

DBGET integrated database retrieval system