Hibiscus syriacus (Rose-of-Sharon): 120157453 Help Entry 120157453         CDS       T09559                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A [EC:3.6.5.2] Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr04142   Lysosome biogenesis hsyr04144   Endocytosis hsyr04145   Phagosome hsyr04148   Efferocytosis Brite KEGG Orthology (KO) [BR:hsyr00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120157453    04145 Phagosome     120157453    04142 Lysosome biogenesis     120157453    04148 Efferocytosis     120157453  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsyr04131]     120157453   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hsyr04147]     120157453    04031 GTP-binding proteins [BR:hsyr04031]     120157453 Enzymes [BR:hsyr01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.5  Acting on GTP to facilitate cellular and subcellular movement     3.6.5.2  small monomeric GTPase      120157453 Membrane trafficking [BR:hsyr04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     120157453  Endosome - Golgi transport     120157453 Exosome [BR:hsyr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120157453   Exosomal proteins of other body fluids (saliva and urine)    120157453   Exosomal proteins of colorectal cancer cells    120157453   Exosomal proteins of bladder cancer cells    120157453 GTP-binding proteins [BR:hsyr04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     120157453 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_16 cobW ATP_bind_1 Septin PduV-EutP AAA_22 AAA_7 nSTAND3 NACHT NTPase_1 AAA_24 Sigma54_activat MCM AAA_5 nSTAND1 Motif Other DBs NCBI-GeneID:  120157453 NCBI-ProteinID:  XP_039024492 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MSTRRRTLLKVIVLGDSGVGKTSLMNRYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVNVLKSFDTLDNWHEEFLKQANPTDPRMFPF TLLGNKIDIDGGNSRVVSEKKAEDWCASKGNMPYFETSAKEDINVDAAFLCIAKTALANE REQDIYFQGIPEAVTETEQRGGCAC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgtcaacgcgaagacgaaccttgctcaaggtcattgttctcggcgacagcggggttggc aagacgtcgttgatgaatcgatatgttcacaagaagtttagtcagcaatataaagcaact attggtgctgattttgtgaccaaggaacttcagattgatgatcgcctcgtcactctgcag atatgggatactgcaggacaggagcgatttcagagtctcggagtcgccttctataggggt gcagattgctgtgtgctagtttttgatgttaatgttttgaaatcatttgatacgcttgat aattggcatgaggagtttcttaaacaggcaaatccaactgaccccaggatgtttcccttc acgttgcttggaaacaagatagatatagatggtggtaatagtcgagtggtctctgagaag aaagcagaagactggtgtgcttccaaaggaaacatgccttactttgaaacatcagcaaaa gaagatatcaatgttgatgctgcattcctttgtattgccaaaacggctctagcaaatgag cgggagcaggacatatatttccagggcatcccagaggctgtgacagagaccgaacaaaga ggaggttgtgcatgttga

DBGET integrated database retrieval system