Hibiscus syriacus (Rose-of-Sharon): 120161087 Help Entry 120161087         CDS       T09559                                  Name (RefSeq) GTP-binding protein SAR1A-like   KO K07953   GTP-binding protein SAR1 [EC:3.6.5.-] Organism hsyr  Hibiscus syriacus (Rose-of-Sharon) Pathway hsyr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:hsyr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120161087  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hsyr04131]     120161087   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:hsyr04031]     120161087 Membrane trafficking [BR:hsyr04131]  Endoplasmic reticulum (ER) - Golgi transport   Forward pathways    Coat protein complex II (COP-II)     120161087 GTP-binding proteins [BR:hsyr04031]  Small (monomeric) G-proteins   Arf/Sar Family    Sar     120161087 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf G-alpha Motif Other DBs NCBI-GeneID:  120161087 NCBI-ProteinID:  XP_039027303 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MPRAVDAVVYLVDAYDKERFAESKKEVDALLSDESLANVPFLILGNKIDIPYAASEDELR YHLGLTNFTTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWMSQYIK NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgcctagggctgttgatgctgtggtttacctggtagatgcctatgataaagagaggttt gcagagtcaaagaaggaagtagatgcactcctttcagacgagtcacttgccaatgtaccg tttcttatcctaggaaacaagatcgatataccatatgctgcatcagaggatgaattacga taccatcttggtctcacgaactttaccaccggcaaggggaaggtaaatctagcagactca aatgtccgtccactagaggtatttatgtgcagcattgtgcgcaaaatgggatatggtgat ggcttcaagtggatgtctcagtatatcaagtag

DBGET integrated database retrieval system